Project name: SH3_Y90M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA90M
Energy difference between WT (input) and mutated protein (by FoldX)	-0.24822 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.6072
• Maximal score value: 1.2498
• Average score: -0.9229
• Total score value: -55.3737

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0796
87	V	A	-0.6371
88	A	A	0.0000
89	L	A	-0.4803
90	M	A	-1.2592	mutated: YA90M
91	D	A	-3.1164
92	Y	A	-2.2434
93	E	A	-2.8834
94	S	A	0.0000
95	R	A	-2.7841
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3233
100	L	A	0.0000
101	S	A	-1.9046
102	F	A	0.0000
103	K	A	-3.6072
104	K	A	-3.0609
105	G	A	-2.0271
106	E	A	0.0000
107	R	A	-2.0603
108	L	A	0.0000
109	Q	A	-0.2450
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3468
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2993
135	N	A	-1.3161
136	Y	A	-0.3618
137	V	A	0.0000
138	A	A	0.0048
139	P	A	-0.1418
140	S	A	-0.1665