Project name: SH3_Y92S

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92S
Energy difference between WT (input) and mutated protein (by FoldX)	4.66468 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.562
• Maximal score value: 1.2501
• Average score: -0.9625
• Total score value: -57.7499

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.0992
87	V	A	-0.6171
88	A	A	0.0000
89	L	A	-0.3368
90	Y	A	-0.8117
91	D	A	-2.9956
92	S	A	-2.4223	mutated: YA92S
93	E	A	-3.0631
94	S	A	-2.3203
95	R	A	-2.8586
96	T	A	-2.2108
97	E	A	-2.4009
98	T	A	-1.3185
99	D	A	-1.5048
100	L	A	0.0000
101	S	A	-2.0478
102	F	A	0.0000
103	K	A	-3.5620
104	K	A	-2.9090
105	G	A	-1.9647
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4374
111	V	A	1.2501
112	N	A	-0.4038
113	N	A	-1.7902
114	T	A	-1.7162
115	E	A	-2.9037
116	G	A	-2.5790
117	D	A	-2.6346
118	W	A	-1.2473
119	W	A	-0.6629
120	L	A	0.4052
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8785
127	G	A	-0.8169
128	Q	A	-1.4280
129	T	A	-0.5215
130	G	A	0.0000
131	Y	A	0.1806
132	I	A	0.0000
133	P	A	-0.5644
134	S	A	-1.2476
135	N	A	-1.2210
136	Y	A	-0.2044
137	V	A	0.0000
138	A	A	-0.0115
139	P	A	-0.1505
140	S	A	-0.1759