Project name: 12_wo [mutate: DA169G]

Status: done

submitted: 2018-11-07 12:30:33, status changed: 2018-11-07 12:41:35
Settings
Chain sequence(s) A: KTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQ
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues DA169G
Energy difference between WT (input) and mutated protein (by FoldX) -0.690852 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.5798
Maximal score value
0.6776
Average score
-1.1755
Total score value
-197.4913

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
102 K A -2.6849
103 T A -1.7729
104 S A 0.0000
105 D A 0.0000
106 L A 0.0000
107 I A 0.0078
108 V A 0.0000
109 L A 0.0662
110 G A -0.2468
111 L A 0.0000
112 P A -0.4729
113 W A -0.3871
114 K A -1.4766
115 T A -1.3639
116 T A -1.3164
117 E A -1.9589
118 Q A -2.4978
119 D A -2.4370
120 L A 0.0000
121 K A -2.2766
122 E A -2.7348
123 Y A -1.1752
124 F A 0.0000
125 S A -1.1269
126 T A -0.5845
127 F A -0.4399
128 G A -1.2614
129 E A -1.8099
130 V A 0.0000
131 L A 0.6776
132 M A 0.0000
133 V A 0.0000
134 Q A 0.0000
135 V A -0.6014
136 K A -1.3524
137 K A -2.1170
138 D A -1.5285
139 L A -0.3422
140 K A -1.4256
141 T A -1.3511
142 G A -1.3692
143 H A -2.0756
144 S A -1.8919
145 K A -2.3911
146 G A 0.0000
147 F A 0.0000
148 G A 0.0000
149 F A 0.1462
150 V A 0.0000
151 R A -0.1431
152 F A 0.0000
153 T A -1.1887
154 E A -2.4317
155 Y A -1.6975
156 E A -2.1388
157 T A 0.0000
158 Q A 0.0000
159 V A -0.6635
160 K A -0.9670
161 V A 0.0000
162 M A -0.7973
163 S A -1.1560
164 Q A -2.1117
165 R A -2.2544
166 H A 0.0000
167 M A -0.1667
168 I A 0.0000
169 G A -1.1594 mutated: DA169G
170 G A -0.9759
171 R A -1.1214
172 W A -0.2078
173 C A 0.0000
174 D A -1.1557
175 C A 0.0000
176 K A -0.9844
177 L A -0.4787
178 P A -0.9225
179 N A -1.6206
180 S A -1.2748
181 K A -1.6146
182 Q A -2.2765
183 S A -2.0845
184 Q A -3.0714
185 D A -3.5682
186 E A -2.8288
187 P A -1.3378
188 L A -0.2075
189 R A -2.4126
190 S A -3.1454
191 R A -3.0225
192 K A -2.4340
193 V A 0.0000
194 F A -0.0711
195 V A 0.0000
196 G A 0.0000
197 R A -1.2689
198 C A 0.0000
199 T A -1.6950
200 E A -2.6863
201 D A -2.9879
202 M A 0.0000
203 T A -1.8890
204 E A -1.9714
205 D A -3.2244
206 E A -3.0082
207 L A 0.0000
208 R A -3.0247
209 E A -3.2673
210 F A -1.8738
211 F A 0.0000
212 S A -1.6295
213 Q A -1.6888
214 Y A -0.4529
215 G A -1.2934
216 D A -1.9581
217 V A 0.0000
218 M A -0.7898
219 D A -1.8131
220 V A -1.0553
221 F A 0.3122
222 I A 0.0000
223 P A -0.8231
224 K A -1.8953
225 P A -1.6455
226 F A -1.3327
227 R A -1.8669
228 A A -0.8600
229 F A -0.0001
230 A A 0.0000
231 F A 0.2375
232 V A 0.0000
233 T A -1.3024
234 F A 0.0000
235 A A -1.6271
236 D A -2.5418
237 D A -3.5798
238 Q A -2.8899
239 I A -1.9191
240 A A 0.0000
241 Q A -2.2153
242 S A -1.3606
243 L A 0.0000
244 C A 0.0000
245 G A -1.9422
246 E A -2.1152
247 D A 0.0000
248 L A 0.0000
249 I A -0.1098
250 I A 0.0000
251 K A -1.9439
252 G A -0.7533
253 I A -0.6418
254 S A 0.0000
255 V A 0.0000
256 H A -0.6872
257 I A 0.0000
258 S A -0.7078
259 N A -1.3131
260 A A 0.0000
261 E A -2.9569
262 P A -2.9492
263 K A -3.1862
264 H A -2.6901
265 N A -3.1700
266 S A -2.8551
267 N A -3.2932
268 R A -3.3553
269 Q A -2.6682

 

Laboratory of Theory of Biopolymers 2015