Project name: SH3_S101M

Status: done

submitted: 2019-03-14 15:20:22, status changed: 2019-03-14 16:37:10
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues SA101M
Energy difference between WT (input) and mutated protein (by FoldX) 0.297978 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.0631
Maximal score value
1.2498
Average score
-0.8726
Total score value
-52.3536

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.5942
88 A A 0.0000
89 L A -0.2653
90 Y A -0.6572
91 D A -2.5825
92 Y A -1.8105
93 E A -2.5587
94 S A -1.9359
95 R A -2.6878
96 T A -2.0774
97 E A -2.3565
98 T A -1.1658
99 D A -1.1576
100 L A 0.0000
101 M A -1.1233 mutated: SA101M
102 F A 0.0000
103 K A -3.0631
104 K A -2.7229
105 G A -1.8908
106 E A 0.0000
107 R A -2.0472
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6978
120 L A 0.4047
121 A A 0.0000
122 H A -0.3866
123 S A 0.0000
124 L A -0.2875
125 T A -0.7658
126 T A -0.7832
127 G A -0.8235
128 Q A -1.2982
129 T A -0.3900
130 G A 0.0000
131 Y A 0.3170
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2011
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015