Project name: SH3_R107V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	RA107V
Energy difference between WT (input) and mutated protein (by FoldX)	0.545244 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.1978
• Maximal score value: 1.2307
• Average score: -0.7339
• Total score value: -44.0338

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4610
82	S	A	-0.6962
83	H	A	-0.8024
84	M	A	0.2448
85	T	A	0.3690
86	F	A	0.6051
87	V	A	0.2767
88	A	A	0.0000
89	L	A	-0.3258
90	Y	A	-0.7428
91	D	A	-2.8532
92	Y	A	-2.1058
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1546
97	E	A	-2.3532
98	T	A	-1.2422
99	D	A	-1.3245
100	L	A	0.0000
101	S	A	-1.9038
102	F	A	0.0000
103	K	A	-3.1978
104	K	A	-2.5283
105	G	A	-1.3253
106	E	A	0.0000
107	V	A	0.5650	mutated: RA107V
108	L	A	0.0000
109	Q	A	0.2466
110	I	A	0.6636
111	V	A	1.2307
112	N	A	-0.4197
113	N	A	-1.8088
114	T	A	-1.7292
115	E	A	-2.9341
116	G	A	-2.6073
117	D	A	-2.6850
118	W	A	-1.3420
119	W	A	-0.6976
120	L	A	0.3937
121	A	A	0.0000
122	H	A	-0.0234
123	S	A	0.0000
124	L	A	0.6138
125	T	A	0.0636
126	T	A	-0.4870
127	G	A	-0.7740
128	Q	A	-1.3919
129	T	A	-0.4958
130	G	A	0.0000
131	Y	A	0.2139
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2862
135	N	A	-1.2488
136	Y	A	-0.2110
137	V	A	0.0000
138	A	A	-0.0374
139	P	A	0.1177
140	S	A	0.2233