Project name: 64ed3183f902902 [mutate: PA19S]

Status: done

submitted: 2021-08-10 04:08:45, status changed: 2021-08-10 04:13:47
Settings
Chain sequence(s) A: TPNDLTSRQWGPQKVQAPQAWDVTRSSSSTVIAIVDTGVQTNHPDLQGKIVQGYDFVDNDSNPQDGNGHGTHCAGIAAAVTNNGTGIAGMAPNASIMPVRVLNNSGSGTMAAVANGIAYAAQNGADVISLSLGGTSGSSALQSAVQQAWNSGAVVVAAAGNSSSSTPNYPAYYSQAIAVASTDSNDSLSYFSNYGSWVDVAAPGSNIYSTYLNSSYASLSGTSMATPHVAGLAALLASQGRSNSQIRAAIENTADKISGTGTYFQHGRINAYKAVNY
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues PA19S
Energy difference between WT (input) and mutated protein (by FoldX) 3.4399 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.0938
Maximal score value
1.1529
Average score
-0.5337
Total score value
-147.8239

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
2 T A -1.3434
3 P A -1.9119
4 N A -3.0938
5 D A -2.9897
6 L A -1.6556
7 T A -1.0967
8 S A -1.1492
9 R A -1.7977
10 Q A 0.0000
11 W A 0.0197
12 G A 0.0000
13 P A 0.0000
14 Q A -1.1950
15 K A -0.9524
16 V A 0.0000
17 Q A -0.9366
18 A A 0.0000
19 S A -1.0323 mutated: PA19S
20 Q A -1.3736
21 A A 0.0000
22 W A -1.1837
23 D A -1.9004
24 V A -1.0901
25 T A -1.4035
26 R A -2.3477
27 S A -1.5014
28 S A 0.0000
29 S A -1.1844
30 S A -0.8682
31 T A 0.0000
32 V A -0.1249
33 I A 0.0000
34 A A 0.0000
35 I A 0.0000
36 V A 0.0000
37 D A 0.0000
38 T A 0.0000
39 G A 0.0000
40 V A 0.0000
41 Q A 0.0000
42 T A -1.1902
43 N A -2.0092
44 H A 0.0000
45 P A -1.1182
46 D A 0.0000
47 L A 0.0000
48 Q A -1.7060
49 G A -0.9863
50 K A -0.6524
51 I A 0.0533
52 V A 0.7562
53 Q A -0.2871
54 G A -0.3567
55 Y A -0.9348
56 D A 0.0000
57 F A -1.0099
58 V A -0.9284
59 D A -2.5075
60 N A -2.4653
61 D A -2.3821
62 S A -1.9102
63 N A -2.4399
64 P A 0.0000
65 Q A -2.0386
66 D A 0.0000
67 G A -1.6240
68 N A -1.5248
69 G A 0.0000
70 H A -0.4044
71 G A 0.0000
72 T A 0.0000
73 H A 0.0000
74 C A 0.0000
75 A A 0.0000
76 G A 0.0000
77 I A 0.0000
78 A A 0.0000
79 A A 0.0000
80 A A 0.0000
81 V A -0.8379
82 T A -1.4896
83 N A -2.5336
84 N A -2.0021
85 G A -1.9874
86 T A -1.2563
87 G A -1.1554
88 I A 0.0000
89 A A 0.0000
90 G A 0.0000
91 M A 0.0000
92 A A 0.0000
93 P A -0.7854
94 N A -1.5116
95 A A 0.0000
96 S A -0.1265
97 I A 0.0000
98 M A 0.0000
99 P A 0.0000
100 V A 0.0000
101 R A 0.0000
102 V A 0.0000
103 L A 0.0000
104 N A -1.6684
105 N A -2.2222
106 S A -1.4352
107 G A -1.2654
108 S A -1.0475
109 G A -0.7134
110 T A -0.1129
111 M A -0.1516
112 A A -0.1725
113 A A -0.3027
114 V A 0.0000
115 A A -0.7011
116 N A -0.9621
117 G A 0.0000
118 I A 0.0000
119 A A -0.9685
120 Y A -0.5779
121 A A 0.0000
122 A A -1.3209
123 Q A -1.6117
124 N A -1.3252
125 G A -1.2308
126 A A 0.0000
127 D A -0.9514
128 V A 0.0000
129 I A 0.0000
130 S A 0.0000
131 L A 0.0000
132 S A 0.0000
133 L A -0.3074
134 G A -0.5425
135 G A -0.4695
136 T A -0.3331
137 S A -0.3691
138 G A -0.4194
139 S A -0.4316
140 S A -0.5280
141 A A -0.5173
142 L A 0.0000
143 Q A -1.1029
144 S A -1.0637
145 A A 0.0000
146 V A 0.0000
147 Q A -1.6843
148 Q A -2.1878
149 A A 0.0000
150 W A -1.3585
151 N A -1.9976
152 S A -1.6522
153 G A -1.2839
154 A A 0.0000
155 V A 0.0000
156 V A 0.0000
157 V A 0.0000
158 A A 0.0000
159 A A 0.0000
160 A A 0.0000
161 G A -0.8326
162 N A -1.2353
163 S A -0.7582
164 S A -0.2707
165 S A -0.2619
166 S A -0.1126
167 T A -0.1262
168 P A 0.0255
169 N A 0.0000
170 Y A 0.0181
171 P A 0.0000
172 A A 0.0000
173 Y A 0.6179
174 Y A 0.0000
175 S A -0.2358
176 Q A -0.6899
177 A A 0.0000
178 I A 0.0000
179 A A 0.0000
180 V A 0.0000
181 A A 0.0000
182 S A 0.0000
183 T A 0.0000
184 D A -0.9823
185 S A -1.1959
186 N A -1.6777
187 D A -1.1443
188 S A -0.5115
189 L A 0.3654
190 S A 0.0000
191 Y A 1.1529
192 F A 0.2863
193 S A 0.0000
194 N A 0.0000
195 Y A 0.1373
196 G A 0.0000
197 S A -0.4031
198 W A 0.0435
199 V A 0.0000
200 D A -0.4690
201 V A 0.0000
202 A A 0.0000
203 A A 0.0000
204 P A 0.0000
205 G A 0.0000
206 S A -0.4717
207 N A -1.3585
208 I A 0.0000
209 Y A -0.3308
210 S A 0.0000
211 T A 0.0000
212 Y A 0.2702
213 L A -0.2685
214 N A -1.0368
215 S A -0.7441
216 S A -0.2319
217 Y A 0.2452
218 A A 0.2326
219 S A -0.4168
220 L A -0.0236
221 S A -0.5720
222 G A 0.0000
223 T A 0.0000
224 S A -0.2277
225 M A 0.0000
226 A A 0.0000
227 T A 0.0000
228 P A 0.0000
229 H A 0.0000
230 V A 0.0000
231 A A 0.0000
232 G A 0.0000
233 L A 0.0000
234 A A 0.0000
235 A A 0.0000
236 L A 0.0000
237 L A 0.0000
238 A A -0.8915
239 S A 0.0000
240 Q A -1.2303
241 G A -1.1689
242 R A -0.9257
243 S A -1.0208
244 N A -1.1697
245 S A -0.9791
246 Q A -0.9739
247 I A 0.0000
248 R A -0.8839
249 A A -0.7241
250 A A 0.0000
251 I A 0.0000
252 E A -1.2068
253 N A -1.3970
254 T A -1.1036
255 A A 0.0000
256 D A -1.4452
257 K A -1.9866
258 I A -0.9082
259 S A -0.6112
260 G A -0.4786
261 T A -1.0309
262 G A -1.0487
263 T A -0.3127
264 Y A 0.1850
265 F A 0.0000
266 Q A -1.3281
267 H A -1.4654
268 G A 0.0000
269 R A 0.0000
270 I A 0.0000
271 N A 0.0000
272 A A 0.0000
273 Y A -0.5334
274 K A -1.0673
275 A A 0.0000
276 V A 0.0000
277 N A -0.7459
278 Y A 0.2781

 

Laboratory of Theory of Biopolymers 2015