| Chain sequence(s) | B: FVNQHLCGSHLVEALYLVCGERGFFYTPKA |
| Distance of aggregation | 5 Å |
| Dynamic mode | Yes |
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | F | B | 2.2639 | |
| 2 | V | B | 1.8877 | |
| 3 | N | B | -1.1438 | |
| 4 | Q | B | -1.5905 | |
| 5 | H | B | -0.9722 | |
| 6 | L | B | 1.2678 | |
| 7 | C | B | 0.9171 | |
| 8 | G | B | -0.1131 | |
| 9 | S | B | -0.3102 | |
| 10 | H | B | -0.7526 | |
| 11 | L | B | 1.5484 | |
| 12 | V | B | 1.6985 | |
| 13 | E | B | -1.3418 | |
| 14 | A | B | -0.0485 | |
| 15 | L | B | 0.5826 | |
| 16 | Y | B | 1.4347 | |
| 17 | L | B | 2.1173 | |
| 18 | V | B | 2.0930 | |
| 19 | C | B | 0.4110 | |
| 20 | G | B | -0.7501 | |
| 21 | E | B | -2.2220 | |
| 22 | R | B | -2.2569 | |
| 23 | G | B | -0.5074 | |
| 24 | F | B | 2.2135 | |
| 25 | F | B | 2.3810 | |
| 26 | Y | B | 0.8132 | |
| 27 | T | B | -0.0342 | |
| 28 | P | B | -0.5716 | |
| 29 | K | B | -1.7347 | |
| 30 | A | B | -0.3042 |
Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).
Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, 0.2325 in this case) is selected and presented in A3D results.