Project name: SH3_S82Q

Status: done

submitted: 2019-03-14 15:08:09, status changed: 2019-03-14 15:15:42
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues SA82Q
Energy difference between WT (input) and mutated protein (by FoldX) -0.0567071 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.2606
Average score
-0.9361
Total score value
-56.1648

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.9278
82 Q A -1.6610 mutated: SA82Q
83 H A -1.2649
84 M A -0.0131
85 T A 0.0000
86 F A -0.0928
87 V A -0.6163
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2414
99 D A -1.3229
100 L A 0.0000
101 S A -1.9034
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0727
108 L A 0.0000
109 Q A -0.3659
110 I A 0.3489
111 V A 1.2606
112 N A -0.4153
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6986
120 L A 0.4095
121 A A 0.0000
122 H A -0.3838
123 S A 0.0000
124 L A -0.3043
125 T A -0.7972
126 T A -0.8888
127 G A -0.8294
128 Q A -1.4198
129 T A -0.4968
130 G A 0.0000
131 Y A 0.2187
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1457
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015