Project name: SH3_S94Y

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94Y
Energy difference between WT (input) and mutated protein (by FoldX)	4.99519 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4939
• Maximal score value: 1.2501
• Average score: -0.8977
• Total score value: -53.8611

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1029
87	V	A	-0.6231
88	A	A	0.0000
89	L	A	-0.3224
90	Y	A	-0.7626
91	D	A	-2.8731
92	Y	A	-1.9713
93	E	A	-2.5648
94	Y	A	-1.5025	mutated: SA94Y
95	R	A	-2.4540
96	T	A	-1.9228
97	E	A	-2.2137
98	T	A	-1.1015
99	D	A	-1.0478
100	L	A	0.0000
101	S	A	-1.6541
102	F	A	0.0000
103	K	A	-3.4939
104	K	A	-2.8739
105	G	A	-1.9662
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4375
111	V	A	1.2501
112	N	A	-0.4182
113	N	A	-1.8118
114	T	A	-1.7313
115	E	A	-2.9334
116	G	A	-2.6087
117	D	A	-2.6858
118	W	A	-1.3305
119	W	A	-0.6895
120	L	A	0.4169
121	A	A	0.0000
122	H	A	-0.3837
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8766
127	G	A	-0.8169
128	Q	A	-1.4023
129	T	A	-0.4792
130	G	A	0.0000
131	Y	A	0.3325
132	I	A	0.0000
133	P	A	-0.5483
134	S	A	-1.2896
135	N	A	-1.2508
136	Y	A	-0.2076
137	V	A	0.0000
138	A	A	-0.0185
139	P	A	-0.1505
140	S	A	-0.1759