Project name: SH3_A138M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	AA138M
Energy difference between WT (input) and mutated protein (by FoldX)	-1.17507 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5327
• Maximal score value: 1.2498
• Average score: -0.8768
• Total score value: -52.6077

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2707
85	T	A	0.0000
86	F	A	0.0437
87	V	A	-0.6226
88	A	A	0.0000
89	L	A	-0.3654
90	Y	A	-0.8426
91	D	A	-2.8868
92	Y	A	-2.1244
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.5327
104	K	A	-2.9607
105	G	A	-2.0678
106	E	A	0.0000
107	R	A	-2.1446
108	L	A	0.0000
109	Q	A	-0.2745
110	I	A	0.4392
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.1629
135	N	A	-1.1260
136	Y	A	-0.1257
137	V	A	0.0000
138	M	A	0.6795	mutated: AA138M
139	P	A	0.1999
140	S	A	-0.0318