Project name: SH3_I110G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110G
Energy difference between WT (input) and mutated protein (by FoldX)	4.69303 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.9329
• Average score: -0.9432
• Total score value: -56.5939

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5367
82	S	A	-0.7598
83	H	A	-0.7912
84	M	A	0.1774
85	T	A	0.0000
86	F	A	-0.1828
87	V	A	-0.5926
88	A	A	0.0000
89	L	A	-0.3052
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1637
97	E	A	-2.3623
98	T	A	-1.2597
99	D	A	-1.3562
100	L	A	0.0000
101	S	A	-1.9153
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9548
106	E	A	0.0000
107	R	A	-2.1250
108	L	A	0.0000
109	Q	A	-0.5674
110	G	A	-0.2355	mutated: IA110G
111	V	A	0.9329
112	N	A	-0.5790
113	N	A	-1.9516
114	T	A	-1.7182
115	E	A	-2.9295
116	G	A	-2.6094
117	D	A	-2.7043
118	W	A	-1.3762
119	W	A	-0.8493
120	L	A	0.2307
121	A	A	0.0000
122	H	A	-0.5563
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4120
129	T	A	-0.5783
130	G	A	0.0000
131	Y	A	0.0723
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3716
135	N	A	-1.2504
136	Y	A	-0.2009
137	V	A	0.0000
138	A	A	-0.0011
139	P	A	-0.1959
140	S	A	-0.1539