Project name: SH3_4JZ4_N135R [mutate: NA135R]

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA135R
Energy difference between WT (input) and mutated protein (by FoldX)	-0.209755 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4735
• Maximal score value: 1.2498
• Average score: -0.9244
• Total score value: -55.4665

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1108
87	V	A	-0.6260
88	A	A	0.0000
89	L	A	-0.3966
90	Y	A	-0.7765
91	D	A	-2.8419
92	Y	A	-2.1046
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4735
104	K	A	-2.8525
105	G	A	-1.9547
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4369
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8145
114	T	A	-1.7328
115	E	A	-2.9366
116	G	A	-2.6722
117	D	A	-2.7881
118	W	A	-1.4288
119	W	A	-0.7577
120	L	A	0.4044
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2194
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.5866
135	R	A	-1.8446	mutated: NA135R
136	Y	A	-0.5280
137	V	A	0.0000
138	A	A	-0.1399
139	P	A	-0.1505
140	S	A	-0.1759