Project name: 6cc96e28e36b1b4

Status: done

submitted: 2019-03-20 17:44:19, status changed: 2019-03-20 17:49:01
Settings
Chain sequence(s) A: EFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLE
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.0344
Maximal score value
1.9982
Average score
-0.2577
Total score value
-20.0998

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
22 E A -1.7260
23 F A 0.3390
24 V A 1.4259
25 E A -0.9618
26 E A -0.4904
27 F A 1.8214
28 N A 0.0584
29 R A 0.0000
30 L A 0.3873
31 K A -1.6126
32 T A -0.3311
33 F A 0.0000
34 A A -0.1748
35 N A -1.2250
36 F A -0.0454
37 P A -0.0984
38 S A -0.3168
39 G A -0.5117
40 S A -0.1391
41 P A -0.1220
42 V A 0.0000
43 S A -0.1497
44 A A -0.0451
45 S A -0.1587
46 T A -0.0728
47 L A 0.0000
48 A A 0.0000
49 R A -1.8441
50 A A 0.0000
51 G A 0.0000
52 F A 0.0000
53 L A 0.2340
54 Y A 0.1620
55 T A -0.0939
56 G A -0.8057
57 E A -1.9912
58 G A -0.8745
59 D A -0.4830
60 T A -0.2263
61 V A 0.0000
62 R A -1.0638
63 C A 0.0000
64 F A 0.2297
65 S A 0.0360
66 C A 0.0085
67 H A -0.9526
68 A A -0.1685
69 A A -0.1512
70 V A 0.0000
71 D A -1.3719
72 R A -2.0344
73 W A 0.0000
74 Q A -0.9527
75 Y A 1.0048
76 G A -0.3128
77 D A -0.6136
78 S A -0.2922
79 A A 0.0000
80 V A 1.5100
81 G A 0.1225
82 R A -0.3479
83 H A 0.0000
84 R A -1.7098
85 K A -1.7645
86 V A 0.7125
87 S A 0.1319
88 P A -0.5562
89 N A -1.3015
90 C A 0.0000
91 R A -1.9104
92 F A 0.0769
93 I A 0.2227
94 N A -1.4136
95 G A -0.0089
96 F A 1.9982
97 Y A 1.0860
98 L A 1.2914
99 E A -1.5323

 

Laboratory of Theory of Biopolymers 2015