Project name: SH3_W118V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	WA118V
Energy difference between WT (input) and mutated protein (by FoldX)	1.17872 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4587
• Maximal score value: 1.2696
• Average score: -0.8848
• Total score value: -53.0905

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1038
87	V	A	-0.6194
88	A	A	0.0000
89	L	A	-0.2931
90	Y	A	-0.6978
91	D	A	-2.8036
92	Y	A	-2.0404
93	E	A	-2.8636
94	S	A	0.0000
95	R	A	-2.8042
96	T	A	-2.2141
97	E	A	-2.4095
98	T	A	-1.3425
99	D	A	-1.4725
100	L	A	0.0000
101	S	A	-1.9301
102	F	A	0.0000
103	K	A	-3.4587
104	K	A	-2.8402
105	G	A	-1.9589
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2387
110	I	A	0.4452
111	V	A	1.2696
112	N	A	-0.3264
113	N	A	-1.7206
114	T	A	-1.6617
115	E	A	-2.8200
116	G	A	-2.5025
117	D	A	-2.5238
118	V	A	-1.0162	mutated: WA118V
119	W	A	-0.5495
120	L	A	0.4577
121	A	A	0.0000
122	H	A	-0.3893
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4275
129	T	A	-0.5399
130	G	A	0.0000
131	Y	A	0.1494
132	I	A	0.0000
133	P	A	-0.4609
134	S	A	-1.1946
135	N	A	-1.2034
136	Y	A	-0.1541
137	V	A	0.0000
138	A	A	-0.0203
139	P	A	-0.1505
140	S	A	-0.1759