Project name: SH3_L120A

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120A
Energy difference between WT (input) and mutated protein (by FoldX)	2.43431 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.1562
• Average score: -0.9219
• Total score value: -55.3165

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1550
97	E	A	-2.3556
98	T	A	-1.2833
99	D	A	-1.3707
100	L	A	0.0000
101	S	A	-1.9066
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0701
108	L	A	0.0000
109	Q	A	-0.2881
110	I	A	0.3611
111	V	A	1.1562
112	N	A	-0.5212
113	N	A	-1.8754
114	T	A	-1.7674
115	E	A	-2.9700
116	G	A	-2.6079
117	D	A	-2.6804
118	W	A	-1.4000
119	W	A	-0.8309
120	A	A	0.1222	mutated: LA120A
121	A	A	0.0000
122	H	A	-0.4506
123	S	A	0.0000
124	L	A	-0.2747
125	T	A	-0.7775
126	T	A	-0.8759
127	G	A	-0.8137
128	Q	A	-1.4212
129	T	A	-0.5676
130	G	A	-0.3216
131	Y	A	0.1091
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3148
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759