Project name: SH3_K103T

Status: done

submitted: 2019-03-14 15:21:20, status changed: 2019-03-14 16:42:45
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues KA103T
Energy difference between WT (input) and mutated protein (by FoldX) -0.0419424 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-2.9363
Maximal score value
1.2498
Average score
-0.7962
Total score value
-47.7711

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.4454
88 A A 0.0000
89 L A -0.0492
90 Y A -0.3201
91 D A -2.1313
92 Y A -1.6898
93 E A -2.6317
94 S A 0.0000
95 R A -2.7837
96 T A -2.1541
97 E A -2.3526
98 T A -1.2414
99 D A -1.3230
100 L A 0.0000
101 S A -1.5681
102 F A 0.0000
103 T A -1.8399 mutated: KA103T
104 K A -2.0535
105 G A -1.5375
106 E A 0.0000
107 R A -1.8950
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4372
111 V A 1.2498
112 N A -0.4200
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.6978
120 L A 0.4047
121 A A 0.0000
122 H A -0.3867
123 S A 0.0000
124 L A -0.2877
125 T A -0.6090
126 T A -0.7128
127 G A -0.8239
128 Q A -1.4163
129 T A -0.4961
130 G A 0.0000
131 Y A 0.2196
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015