Project name: SH3_Y131S

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA131S
Energy difference between WT (input) and mutated protein (by FoldX)	1.16437 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4774
• Maximal score value: 1.0198
• Average score: -0.9384
• Total score value: -56.3057

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.7095
91	D	A	-2.8409
92	Y	A	-2.1016
93	E	A	-2.8819
94	S	A	0.0000
95	R	A	-2.7821
96	T	A	-2.2095
97	E	A	-2.4088
98	T	A	-1.3388
99	D	A	-1.4856
100	L	A	0.0000
101	S	A	-1.9756
102	F	A	0.0000
103	K	A	-3.4774
104	K	A	-2.8504
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2731
110	I	A	0.3004
111	V	A	1.0198
112	N	A	-0.9131
113	N	A	-2.0490
114	T	A	-1.8436
115	E	A	-2.9706
116	G	A	-2.6388
117	D	A	-2.6998
118	W	A	-1.4118
119	W	A	-0.8589
120	L	A	0.2764
121	A	A	0.0000
122	H	A	-0.4573
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4108
129	T	A	-0.5434
130	G	A	0.0000
131	S	A	-0.2355	mutated: YA131S
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2955
135	N	A	-1.2349
136	Y	A	-0.1910
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759