Project name: SH3_N112A

Status: done

submitted: 2019-03-14 15:26:01, status changed: 2019-03-14 17:14:19
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues NA112A
Energy difference between WT (input) and mutated protein (by FoldX) 1.59673 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.5318
Average score
-0.8627
Total score value
-51.7641

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1650
97 E A -2.3637
98 T A -1.2624
99 D A -1.3628
100 L A 0.0000
101 S A -1.9172
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.1744
110 I A 0.5989
111 V A 1.5318
112 A A 0.1529 mutated: NA112A
113 N A -1.5413
114 T A -1.5614
115 E A -2.8398
116 G A -2.5587
117 D A -2.7088
118 W A -1.3131
119 W A -0.5491
120 L A 0.6104
121 A A 0.0000
122 H A -0.3270
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.5072
130 G A 0.0000
131 Y A 0.2067
132 I A 0.0000
133 P A 0.0000
134 S A -1.3031
135 N A -1.2524
136 Y A -0.2068
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015