Project name: SH3_Q109N

Status: done

submitted: 2019-03-14 15:24:14, status changed: 2019-03-14 17:00:24
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues QA109N
Energy difference between WT (input) and mutated protein (by FoldX) 0.732886 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
1.3064
Average score
-0.8756
Total score value
-52.5335

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4188
82 S A -0.6394
83 H A -0.7603
84 M A 0.3223
85 T A 0.0000
86 F A -0.0334
87 V A -0.5856
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1540
97 E A -2.3526
98 T A -1.2410
99 D A -1.3224
100 L A 0.0000
101 S A -1.9031
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -1.9889
108 L A 0.0000
109 N A 0.0241 mutated: QA109N
110 I A 0.5525
111 V A 1.3064
112 N A -0.3958
113 N A -1.8142
114 T A -1.7328
115 E A -2.9363
116 G A -2.6085
117 D A -2.6844
118 W A -1.3424
119 W A -0.7068
120 L A 0.4260
121 A A 0.0000
122 H A -0.3379
123 S A 0.0000
124 L A -0.1234
125 T A -0.7324
126 T A -0.8495
127 G A -0.7859
128 Q A -1.4079
129 T A -0.4787
130 G A 0.0000
131 Y A 0.2081
132 I A 0.0000
133 P A 0.0000
134 S A -1.2857
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1211
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015