Project name: SH3_G105N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	GA105N
Energy difference between WT (input) and mutated protein (by FoldX)	3.01364 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.6746
• Maximal score value: 1.2498
• Average score: -0.9414
• Total score value: -56.4853

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.2473
87	V	A	-0.9568
88	A	A	0.0000
89	L	A	-0.5337
90	Y	A	-0.8821
91	D	A	-2.9524
92	Y	A	-2.0975
93	E	A	-2.8775
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3229
100	L	A	0.0000
101	S	A	-1.8981
102	F	A	0.0000
103	K	A	-3.6746
104	K	A	-3.2578
105	N	A	-2.7887	mutated: GA105N
106	E	A	0.0000
107	R	A	-2.2998
108	L	A	0.0000
109	Q	A	-0.2611
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2794
125	T	A	-0.8813
126	T	A	-0.8752
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.2197
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2478
136	Y	A	-0.2158
137	V	A	0.0000
138	A	A	-0.0497
139	P	A	-0.1748
140	S	A	-0.2028