Project name: CH2 A3D [mutate: LA251K]

Status: done

submitted: 2018-11-18 12:06:50, status changed: 2018-11-18 12:14:27
Settings
Chain sequence(s) A: GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues LA251K
Energy difference between WT (input) and mutated protein (by FoldX) 0.0145775 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.5319
Maximal score value
1.07
Average score
-1.1418
Total score value
-122.1724

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
236 G A -0.8024
237 G A -0.8570
238 P A 0.0000
239 S A -0.2828
240 V A 0.0000
241 F A 0.9834
242 L A 0.0000
243 F A 0.8248
244 P A -0.7213
245 P A 0.0000
246 K A -2.7925
247 P A -2.3146
248 K A -2.8818
249 D A 0.0000
250 T A 0.0000
251 K A -2.1930 mutated: LA251K
252 M A -0.5944
253 I A 0.9694
254 S A -0.2017
255 R A -1.9454
256 T A -1.1209
257 P A 0.0000
258 E A -1.0427
259 V A 0.0000
260 T A 0.2268
261 C A 0.0000
262 V A 0.0000
263 V A 0.0000
264 V A -0.5222
265 D A -1.4934
266 V A 0.0000
267 S A -2.1538
268 H A -2.2511
269 E A -2.8808
270 D A -2.6281
271 P A -2.4401
272 E A -3.0464
273 V A -1.9436
274 K A -2.2497
275 F A -1.2981
276 N A -1.4668
277 W A 0.0000
278 Y A -0.9098
279 V A -0.9566
280 D A -1.9563
281 G A -0.9064
282 V A 0.3523
283 E A -1.2378
284 V A -0.6698
285 H A -1.7594
286 N A -1.6613
287 A A -1.5995
288 K A -2.3114
289 T A -1.9852
290 K A -2.6059
291 P A -2.4287
292 R A -3.3601
293 E A -3.5319
294 E A -3.0035
295 Q A -1.6338
296 Y A 0.1595
297 N A -0.7769
298 S A -1.1746
299 T A -1.8410
300 Y A -2.3638
301 R A -2.3153
302 V A 0.0000
303 V A 0.0000
304 S A 0.0000
305 V A -0.7901
306 L A 0.0000
307 T A -0.4655
308 V A 0.0000
309 L A 1.0700
310 H A -0.0787
311 Q A -0.7947
312 D A -1.1873
313 W A 0.0000
314 L A -0.6240
315 N A -1.6877
316 G A -2.2136
317 K A -2.2864
318 E A -2.7016
319 Y A 0.0000
320 K A -1.7819
321 C A 0.0000
322 K A -1.7878
323 V A 0.0000
324 S A -1.5175
325 N A 0.0000
326 K A -2.5631
327 A A -1.4094
328 L A -0.6425
329 P A -0.4355
330 A A -0.4354
331 P A -0.9801
332 I A -0.6968
333 E A -2.0709
334 K A -1.4467
335 T A -1.5953
336 I A 0.0000
337 S A -2.4204
338 K A -2.7656
339 A A -1.9469
340 K A -2.6748
341 G A -2.1001
342 Q A -1.5447

 

Laboratory of Theory of Biopolymers 2015