Project name: 7563e8023ff6faf

Status: done

submitted: 2018-12-16 16:20:44, status changed: 2018-12-16 16:29:28
Settings
Chain sequence(s) P: FTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.1529
Maximal score value
1.5058
Average score
-1.3107
Total score value
-157.287

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
15 F P -0.0093
16 T P -0.7895
17 Y P -1.2010
18 R P -2.1710
19 G P -1.3625
20 V P -1.4856
21 D P -1.8655
22 L P -1.3569
23 D P -2.6882
24 Q P -2.5377
25 L P 0.0000
26 L P -0.9172
27 D P -2.1375
28 M P -1.3078
29 S P -0.9223
30 Y P -0.7468
31 E P -2.3519
32 Q P -1.9018
33 L P 0.0000
34 M P -1.8015
35 Q P -2.0411
36 L P -1.2214
37 Y P 0.0000
38 S P -1.4592
39 A P -2.1574
40 R P -2.9965
41 Q P -2.7353
42 R P -3.7370
43 R P -4.0451
44 R P -2.9187
45 L P 0.0000
46 N P -3.5470
47 R P -3.5611
48 G P -2.5083
49 L P -2.2342
50 R P -3.5111
51 R P -3.6905
52 K P -3.2639
53 Q P 0.0000
54 H P -2.7865
55 S P -2.7332
56 L P 0.0000
57 L P 0.0000
58 K P -3.3276
59 R P -3.3874
60 L P 0.0000
61 R P -3.8587
62 K P -4.1529
63 A P 0.0000
64 K P -3.7683
65 K P -3.9991
66 E P -3.7822
67 A P -2.8824
68 P P -1.8351
69 P P -0.7392
70 M P -0.2196
71 E P -2.1976
72 K P -2.3681
73 P P 0.0000
74 E P -2.5400
75 V P -0.5811
76 V P 0.0000
77 K P -1.7452
78 T P 0.0000
79 H P -1.4998
80 L P 0.0000
81 R P -1.4878
82 D P -1.4786
83 M P 0.0000
84 I P 0.0000
85 I P 0.0000
86 L P 0.0000
87 P P 0.0000
88 E P -0.5596
89 M P 0.0000
90 V P -0.7962
91 G P -1.1041
92 S P 0.0000
93 M P -1.3551
94 V P 0.0000
95 G P 0.0000
96 V P 0.0000
97 Y P -0.9212
98 N P -0.6429
99 G P -1.1050
100 K P -1.6979
101 T P -0.8552
102 F P -0.5964
103 N P -0.8727
104 Q P -1.5166
105 V P 0.0000
106 E P -2.2044
107 I P 0.0000
108 K P -2.4228
109 P P -1.5823
110 E P -2.1740
111 M P -1.2861
112 I P 0.0000
113 G P -0.6032
114 H P -1.0286
115 Y P -0.6432
116 L P 0.0000
117 G P 0.0000
118 E P -1.4528
119 F P -0.4482
120 S P 0.0000
121 I P 0.8774
122 T P 0.2834
123 Y P 0.6986
124 K P -0.7432
125 P P -0.2391
126 V P 0.2480
127 K P -1.7094
128 H P -2.0377
129 G P -2.1533
130 R P -2.5142
131 P P -1.2624
132 G P -0.1895
133 I P 1.5058
134 G P 0.3693

 

Laboratory of Theory of Biopolymers 2015