Project name: SH3_S134H

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134H
Energy difference between WT (input) and mutated protein (by FoldX)	-0.432357 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.259
• Average score: -0.9133
• Total score value: -54.7976

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4501
82	S	A	-0.6818
83	H	A	-0.7912
84	M	A	0.2696
85	T	A	0.0000
86	F	A	-0.0954
87	V	A	-0.6186
88	A	A	0.0000
89	L	A	-0.3116
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1552
97	E	A	-2.3537
98	T	A	-1.2439
99	D	A	-1.3307
100	L	A	0.0000
101	S	A	-1.9048
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9612
106	E	A	0.0000
107	R	A	-2.0685
108	L	A	0.0000
109	Q	A	-0.2410
110	I	A	0.4085
111	V	A	1.2590
112	N	A	-0.4059
113	N	A	-1.8500
114	T	A	-1.7221
115	E	A	-2.9589
116	G	A	-2.6483
117	D	A	-2.7269
118	W	A	-1.4388
119	W	A	-0.7953
120	L	A	0.3569
121	A	A	0.0000
122	H	A	-0.3830
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4960
130	G	A	0.0000
131	Y	A	0.1656
132	I	A	0.0000
133	P	A	0.0000
134	H	A	-1.6262	mutated: SA134H
135	N	A	-1.4120
136	Y	A	-0.3202
137	V	A	0.0000
138	A	A	-0.0741
139	P	A	-0.1464
140	S	A	-0.1731