Project name: SH3_E93W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	EA93W
Energy difference between WT (input) and mutated protein (by FoldX)	-0.296731 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -2.9363
• Maximal score value: 1.2498
• Average score: -0.7433
• Total score value: -44.5985

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.5942
88	A	A	0.0000
89	L	A	-0.2743
90	Y	A	-0.6784
91	D	A	-2.0841
92	Y	A	-0.6067
93	W	A	0.1441	mutated: EA93W
94	S	A	0.0000
95	R	A	-2.0860
96	T	A	-1.7880
97	E	A	-2.3526
98	T	A	-1.2429
99	D	A	-0.8918
100	L	A	0.0000
101	S	A	-0.6684
102	F	A	0.0000
103	K	A	-2.7769
104	K	A	-2.7386
105	G	A	-1.8945
106	E	A	0.0000
107	R	A	-2.0427
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4200
113	N	A	-1.8142
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.6978
120	L	A	0.4047
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7507
126	T	A	-0.8512
127	G	A	-0.8169
128	Q	A	-1.4141
129	T	A	-0.4970
130	G	A	0.0000
131	Y	A	0.2178
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2857
135	N	A	-1.2485
136	Y	A	-0.2088
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759