Project name: SH3_L120C

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120C
Energy difference between WT (input) and mutated protein (by FoldX)	2.48032 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2459
• Average score: -0.9028
• Total score value: -54.1679

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1566
97	E	A	-2.3551
98	T	A	-1.2711
99	D	A	-1.3619
100	L	A	0.0000
101	S	A	-1.9068
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2604
110	I	A	0.4195
111	V	A	1.2459
112	N	A	-0.3688
113	N	A	-1.8006
114	T	A	-1.7197
115	E	A	-2.9374
116	G	A	-2.5961
117	D	A	-2.6869
118	W	A	-1.3737
119	W	A	-0.7582
120	C	A	0.2560	mutated: LA120C
121	A	A	0.0000
122	H	A	-0.4141
123	S	A	0.0000
124	L	A	-0.2799
125	T	A	-0.7803
126	T	A	-0.8783
127	G	A	-0.8173
128	Q	A	-1.4128
129	T	A	-0.5377
130	G	A	0.0000
131	Y	A	0.1315
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3108
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759