Project name: SH3_L120E

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120E
Energy difference between WT (input) and mutated protein (by FoldX)	1.78917 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4774
• Maximal score value: 1.0215
• Average score: -0.9534
• Total score value: -57.2054

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1047
87	V	A	-0.6192
88	A	A	0.0000
89	L	A	-0.2999
90	Y	A	-0.7095
91	D	A	-2.8409
92	Y	A	-2.1027
93	E	A	-2.8834
94	S	A	0.0000
95	R	A	-2.7841
96	T	A	-2.1653
97	E	A	-2.3639
98	T	A	-1.3618
99	D	A	-1.4827
100	L	A	0.0000
101	S	A	-1.9190
102	F	A	0.0000
103	K	A	-3.4774
104	K	A	-2.8504
105	G	A	-1.9568
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.3455
110	I	A	0.2432
111	V	A	1.0215
112	N	A	-0.6525
113	N	A	-1.9728
114	T	A	-1.8094
115	E	A	-3.0159
116	G	A	-2.6027
117	D	A	-2.6953
118	W	A	-1.5283
119	W	A	-1.0760
120	E	A	-0.3552	mutated: LA120E
121	A	A	0.0000
122	H	A	-0.5508
123	S	A	0.0000
124	L	A	-0.2799
125	T	A	-0.7803
126	T	A	-0.8783
127	G	A	-0.8173
128	Q	A	-1.4128
129	T	A	-0.6621
130	G	A	0.0000
131	Y	A	-0.2009
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3882
135	N	A	-1.2468
136	Y	A	-0.1997
137	V	A	0.0000
138	A	A	-0.0219
139	P	A	-0.1505
140	S	A	-0.1759