Project name: SH3_S134K

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA134K
Energy difference between WT (input) and mutated protein (by FoldX)	-0.386748 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4824
• Maximal score value: 1.2438
• Average score: -0.9593
• Total score value: -57.5556

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6216
88	A	A	0.0000
89	L	A	-0.3097
90	Y	A	-0.7310
91	D	A	-2.8500
92	Y	A	-2.1041
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3264
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4824
104	K	A	-2.8592
105	G	A	-1.9610
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.3220
111	V	A	1.2438
112	N	A	-0.4294
113	N	A	-1.9636
114	T	A	-1.7387
115	E	A	-3.0613
116	G	A	-2.8241
117	D	A	-3.0077
118	W	A	-1.6774
119	W	A	-1.0021
120	L	A	0.2696
121	A	A	0.0000
122	H	A	-0.3873
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4950
130	G	A	0.0000
131	Y	A	0.0774
132	I	A	0.0000
133	P	A	0.0000
134	K	A	-2.2976	mutated: SA134K
135	N	A	-1.7418
136	Y	A	-0.5274
137	V	A	0.0000
138	A	A	-0.1770
139	P	A	-0.1505
140	S	A	-0.1759