Project name: SH3_H122V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	HA122V
Energy difference between WT (input) and mutated protein (by FoldX)	-0.433778 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.3078
• Average score: -0.8658
• Total score value: -51.9476

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4686
82	S	A	-0.6944
83	H	A	-0.7997
84	M	A	0.2516
85	T	A	0.0000
86	F	A	-0.1238
87	V	A	-0.6323
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1552
97	E	A	-2.3537
98	T	A	-1.2442
99	D	A	-1.3276
100	L	A	0.0000
101	S	A	-1.9041
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0049
108	L	A	0.0000
109	Q	A	-0.1326
110	I	A	0.5205
111	V	A	1.3078
112	N	A	-0.3767
113	N	A	-1.8213
114	T	A	-1.7346
115	E	A	-2.9328
116	G	A	-2.6059
117	D	A	-2.6855
118	W	A	-1.3436
119	W	A	-0.6472
120	L	A	0.4987
121	A	A	0.0000
122	V	A	0.1710	mutated: HA122V
123	S	A	0.0000
124	L	A	-0.1623
125	T	A	-0.7139
126	T	A	-0.8102
127	G	A	-0.7139
128	Q	A	-1.2578
129	T	A	-0.2630
130	G	A	0.0000
131	Y	A	0.2887
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2879
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1585
140	S	A	-0.1759