Project name: SH3_N112V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA112V
Energy difference between WT (input) and mutated protein (by FoldX)	0.747847 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.6112
• Average score: -0.8279
• Total score value: -49.6719

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4739
82	S	A	-0.6795
83	H	A	-0.7896
84	M	A	0.2727
85	T	A	0.0000
86	F	A	-0.0907
87	V	A	-0.6162
88	A	A	0.0000
89	L	A	-0.3115
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1059
93	E	A	-2.8820
94	S	A	0.0000
95	R	A	-2.7843
96	T	A	-2.1657
97	E	A	-2.3642
98	T	A	-1.2687
99	D	A	-1.3724
100	L	A	0.0000
101	S	A	-1.9174
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9610
106	E	A	0.0000
107	R	A	-2.0650
108	L	A	0.0000
109	Q	A	-0.1448
110	I	A	0.6735
111	V	A	1.6112
112	V	A	0.6677	mutated: NA112V
113	N	A	-1.2531
114	T	A	-1.3391
115	E	A	-2.5886
116	G	A	-2.4248
117	D	A	-2.6673
118	W	A	-1.2075
119	W	A	-0.3882
120	L	A	0.7465
121	A	A	0.0000
122	H	A	-0.3104
123	S	A	0.0000
124	L	A	-0.2762
125	T	A	-0.7802
126	T	A	-0.8778
127	G	A	-0.8165
128	Q	A	-1.4117
129	T	A	-0.5384
130	G	A	0.0000
131	Y	A	0.2465
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2890
135	N	A	-1.2523
136	Y	A	-0.2061
137	V	A	0.0000
138	A	A	-0.0180
139	P	A	-0.1444
140	S	A	-0.1727