Project name: SH3_Q109M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	QA109M
Energy difference between WT (input) and mutated protein (by FoldX)	-0.943629 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.5741
• Average score: -0.8087
• Total score value: -48.5232

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.3175
82	S	A	-0.5037
83	H	A	-0.6629
84	M	A	0.4969
85	T	A	0.0000
86	F	A	0.1900
87	V	A	-0.4703
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2408
99	D	A	-1.3222
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-1.7833
108	L	A	0.0000
109	M	A	0.9426	mutated: QA109M
110	I	A	1.0111
111	V	A	1.5741
112	N	A	-0.2771
113	N	A	-1.8138
114	T	A	-1.7326
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.6934
120	L	A	0.5759
121	A	A	0.0000
122	H	A	0.0908
123	S	A	0.0000
124	L	A	0.1002
125	T	A	-0.7123
126	T	A	-0.8286
127	G	A	-0.7523
128	Q	A	-1.3713
129	T	A	-0.3238
130	G	A	0.0000
131	Y	A	0.2258
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2855
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.0287
140	S	A	-0.1759