Project name: SH3_I110V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110V
Energy difference between WT (input) and mutated protein (by FoldX)	1.38138 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.2592
• Average score: -0.8939
• Total score value: -53.6354

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4486
82	S	A	-0.6804
83	H	A	-0.7912
84	M	A	0.2697
85	T	A	0.0000
86	F	A	-0.1005
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2414
99	D	A	-1.3230
100	L	A	0.0000
101	S	A	-1.9034
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0694
108	L	A	0.0000
109	Q	A	-0.2395
110	V	A	0.4566	mutated: IA110V
111	V	A	1.2592
112	N	A	-0.4147
113	N	A	-1.8102
114	T	A	-1.7330
115	E	A	-2.9365
116	G	A	-2.6087
117	D	A	-2.6847
118	W	A	-1.3429
119	W	A	-0.6943
120	L	A	0.4095
121	A	A	0.0000
122	H	A	-0.3792
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.4929
130	G	A	0.0000
131	Y	A	0.2217
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2838
135	N	A	-1.2486
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1484
140	S	A	-0.1759