Project name: SH3_S94W

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	SA94W
Energy difference between WT (input) and mutated protein (by FoldX)	7.50281 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.48
• Maximal score value: 1.2504
• Average score: -0.8884
• Total score value: -53.3032

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1038
87	V	A	-0.6215
88	A	A	0.0000
89	L	A	-0.3103
90	Y	A	-0.7341
91	D	A	-2.8474
92	Y	A	-1.9581
93	E	A	-2.6026
94	W	A	-1.6045	mutated: SA94W
95	R	A	-2.5054
96	T	A	-1.9606
97	E	A	-2.2364
98	T	A	-1.1239
99	D	A	-1.0785
100	L	A	0.0000
101	S	A	-1.6845
102	F	A	0.0000
103	K	A	-3.4800
104	K	A	-2.8601
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4378
111	V	A	1.2504
112	N	A	-0.4116
113	N	A	-1.8020
114	T	A	-1.7247
115	E	A	-2.9204
116	G	A	-2.5922
117	D	A	-2.6557
118	W	A	-1.2750
119	W	A	-0.6605
120	L	A	0.4301
121	A	A	0.0000
122	H	A	-0.3833
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8767
127	G	A	-0.8169
128	Q	A	-1.4035
129	T	A	-0.4808
130	G	A	0.0000
131	Y	A	0.3357
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2649
135	N	A	-1.2380
136	Y	A	-0.1922
137	V	A	0.0000
138	A	A	-0.0202
139	P	A	-0.1505
140	S	A	-0.1759