Project name: 4GA6-use_031497

Status: done

submitted: 2019-07-29 07:07:07, status changed: 2019-07-29 07:14:30
Settings
Chain sequence(s) A: MKAEIRILDMFSGRYTVLINEEDAKEAKLHPDDLVKIEAGKKAVYGSVALSNLVGKGEVGISRDVTDLHNCDFDGDEVSVIPAG
Distance of aggregation 10 Å
Dynamic mode No
Show buried residues

Minimal score value
-4.6015
Maximal score value
1.0719
Average score
-1.1797
Total score value
-99.0935

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.4524
2 K A -2.0058
3 A A 0.0000
4 E A -2.6900
5 I A 0.0000
6 R A -1.4148
7 I A -1.0534
8 L A -0.4687
9 D A -1.5678
10 M A -0.0648
11 F A 0.8726
12 S A -0.0049
13 G A -0.5747
14 R A -0.8860
15 Y A -0.2228
16 T A -0.1059
17 V A 0.0000
18 L A 0.0000
19 I A 0.0000
20 N A -2.6916
21 E A -3.8986
22 E A -4.6015
23 D A -3.6815
24 A A 0.0000
25 K A -4.5217
26 E A -3.9319
27 A A -2.8153
28 K A -3.4593
29 L A 0.0000
30 H A -2.3872
31 P A -1.5340
32 D A -2.0964
33 D A -1.4815
34 L A 0.5939
35 V A 0.0000
36 K A 0.2545
37 I A 0.0000
38 E A -1.7053
39 A A -1.8238
40 G A -1.8634
41 K A -2.5970
42 K A -2.3206
43 A A -1.3207
44 V A 0.0000
45 Y A 0.8825
46 G A 0.0000
47 S A -0.5977
48 V A 0.0000
49 A A -0.8775
50 L A -1.1556
51 S A -0.7530
52 N A -1.4194
53 L A 0.4991
54 V A 0.0000
55 G A -1.7648
56 K A -2.8117
57 G A -2.2037
58 E A -1.7558
59 V A 0.0000
60 G A 0.0000
61 I A 0.0000
62 S A 0.0000
63 R A -2.3937
64 D A -2.0473
65 V A 0.0000
66 T A -1.9883
67 D A -1.9149
68 L A -0.1000
69 H A -1.5647
70 N A -2.2150
71 C A -2.0466
72 D A -2.5316
73 F A -1.3202
74 D A -2.4638
75 G A -2.3514
76 D A -2.7932
77 E A -3.4029
78 V A 0.0000
79 S A -1.1411
80 V A 0.0000
81 I A 1.0719
82 P A 0.4016
83 A A 0.3618
84 G A -0.1742

 

Laboratory of Theory of Biopolymers 2015