Project name: SH3_Y136V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA136V
Energy difference between WT (input) and mutated protein (by FoldX)	2.3745 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4127
• Maximal score value: 1.2498
• Average score: -0.9011
• Total score value: -54.0663

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1392
87	V	A	-0.6442
88	A	A	0.0000
89	L	A	-0.3095
90	Y	A	-0.5951
91	D	A	-2.7634
92	Y	A	-2.0336
93	E	A	-2.8454
94	S	A	0.0000
95	R	A	-2.7751
96	T	A	-2.1519
97	E	A	-2.3506
98	T	A	-1.2380
99	D	A	-1.3121
100	L	A	0.0000
101	S	A	-1.8788
102	F	A	0.0000
103	K	A	-3.4127
104	K	A	-2.8058
105	G	A	-1.9249
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2491
110	I	A	0.4372
111	V	A	1.2498
112	N	A	-0.4205
113	N	A	-1.8150
114	T	A	-1.7334
115	E	A	-2.9374
116	G	A	-2.6133
117	D	A	-2.6944
118	W	A	-1.3891
119	W	A	-0.7060
120	L	A	0.4011
121	A	A	0.0000
122	H	A	-0.3840
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4112
129	T	A	-0.4937
130	G	A	0.0000
131	Y	A	0.2152
132	I	A	0.0000
133	P	A	-0.6551
134	S	A	-1.4028
135	N	A	-1.3864
136	V	A	0.0000	mutated: YA136V
137	V	A	0.0000
138	A	A	-0.0873
139	P	A	-0.1505
140	S	A	-0.1759