Project name: Betv1

Status: done

submitted: 2019-02-15 17:05:33, status changed: 2019-02-15 19:27:43
Settings
Chain sequence(s) A: GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Distance of aggregation 10 Å
Dynamic mode Yes
Show buried residues

Minimal score value
-3.5368
Maximal score value
2.2269
Average score
-0.7342
Total score value
-116.7406

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.3066
2 V A 1.0122
3 F A 0.8699
4 N A -0.6286
5 Y A -0.5859
6 E A -1.7885
7 T A -1.4498
8 E A -1.9287
9 T A -0.7780
10 T A 0.5333
11 S A 1.2008
12 V A 1.7223
13 I A 1.1184
14 P A 0.7093
15 A A 0.0000
16 A A -0.1117
17 R A -0.7014
18 L A 0.0000
19 F A -0.0417
20 K A -1.0571
21 A A 0.0000
22 F A 0.0000
23 I A 1.0331
24 L A 1.0398
25 D A -0.2783
26 G A -0.0649
27 D A -1.2705
28 N A -1.4979
29 L A -0.6722
30 F A -0.7876
31 P A -1.2970
32 K A -2.0724
33 V A -0.7700
34 A A -1.0341
35 P A -1.3195
36 Q A -1.9420
37 A A -1.3521
38 I A 0.0000
39 S A -0.9980
40 S A -0.9546
41 V A -1.1582
42 E A -2.1104
43 N A -1.9857
44 I A -0.6503
45 E A -1.8205
46 G A -1.5819
47 N A -2.2168
48 G A -1.6632
49 G A -1.6206
50 P A -1.6840
51 G A -1.5903
52 T A -1.3041
53 I A -1.2034
54 K A 0.0000
55 K A -1.8148
56 I A 0.0000
57 S A -0.3485
58 F A 0.0000
59 P A -0.5180
60 E A -1.5807
61 G A -0.8394
62 F A 0.3651
63 P A 0.2950
64 F A 1.4787
65 K A 0.0000
66 Y A 0.4383
67 V A 0.0000
68 K A -1.3680
69 D A -1.5456
70 R A -2.1530
71 V A 0.0000
72 D A -1.6448
73 E A -1.5801
74 V A -0.2839
75 D A -1.3007
76 H A -1.3593
77 T A -1.0767
78 N A -1.1413
79 F A -0.0691
80 K A -1.1602
81 Y A 0.0000
82 N A -1.2096
83 Y A -0.6725
84 S A -1.0271
85 V A -0.4332
86 I A -0.0056
87 E A 0.0000
88 G A -0.1077
89 G A 0.0170
90 P A -0.1582
91 I A -0.6999
92 G A -1.0031
93 D A -2.5451
94 T A -2.5975
95 L A 0.0000
96 E A -1.6635
97 K A -1.6588
98 I A 0.0000
99 S A 0.0000
100 N A -0.6877
101 E A -1.1529
102 I A 0.0000
103 K A -0.4130
104 I A 0.0000
105 V A 2.2075
106 A A 1.3950
107 T A 0.0742
108 P A -1.0981
109 D A -1.8655
110 G A -0.7344
111 G A 0.5810
112 S A 0.0000
113 I A 2.2269
114 L A 0.0000
115 K A -0.8789
116 I A 0.0000
117 S A 0.0000
118 N A 0.0000
119 K A -0.8912
120 Y A 0.0000
121 H A -1.1877
122 T A 0.0000
123 K A -2.9275
124 G A -2.5895
125 D A -3.5368
126 H A -3.1815
127 E A -3.4031
128 V A -2.6225
129 K A -3.1314
130 A A -2.4225
131 E A -3.0727
132 Q A -1.7583
133 V A 0.0000
134 K A -2.9432
135 A A -1.7892
136 S A -1.1632
137 K A -1.7306
138 E A -1.7969
139 M A -0.8807
140 G A -0.7053
141 E A -0.9964
142 T A -0.8420
143 L A 0.0000
144 L A 0.0000
145 R A -1.0528
146 A A -0.2968
147 V A 0.0000
148 E A -0.0445
149 S A 0.0964
150 Y A 0.4399
151 L A 0.0000
152 L A 0.4942
153 A A 0.0155
154 H A -0.4453
155 S A -0.5711
156 D A -1.6218
157 A A -0.6428
158 Y A 0.0897
159 N A -1.2719

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.7342 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015