Project name: SH3_I110N

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	IA110N
Energy difference between WT (input) and mutated protein (by FoldX)	2.51449 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 0.9619
• Average score: -0.9435
• Total score value: -56.6129

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.5279
82	S	A	-0.7518
83	H	A	-0.7912
84	M	A	0.1742
85	T	A	0.0000
86	F	A	-0.2309
87	V	A	-0.6233
88	A	A	0.0000
89	L	A	-0.3128
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1625
97	E	A	-2.3611
98	T	A	-1.2576
99	D	A	-1.3544
100	L	A	0.0000
101	S	A	-1.9140
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9623
106	E	A	0.0000
107	R	A	-2.1356
108	L	A	0.0000
109	Q	A	-0.5487
110	N	A	-0.1826	mutated: IA110N
111	V	A	0.9619
112	N	A	-0.5667
113	N	A	-1.9447
114	T	A	-1.7230
115	E	A	-2.9345
116	G	A	-2.6129
117	D	A	-2.7061
118	W	A	-1.3808
119	W	A	-0.8563
120	L	A	0.2378
121	A	A	0.0000
122	H	A	-0.5412
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5699
130	G	A	0.0000
131	Y	A	0.0793
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3679
135	N	A	-1.2519
136	Y	A	-0.2066
137	V	A	0.0000
138	A	A	-0.0218
139	P	A	-0.2162
140	S	A	-0.1766