Project name: SH3_N112Q

Status: done

submitted: 2019-03-14 15:26:29, status changed: 2019-03-14 17:15:39
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues NA112Q
Energy difference between WT (input) and mutated protein (by FoldX) 0.613036 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
0.2668
Average score
-0.9763
Total score value
-58.5801

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.5371
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1474
97 E A -2.3459
98 T A -1.2288
99 D A -1.3015
100 L A 0.0000
101 S A -1.8951
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.5159
110 I A -0.0715
111 V A 0.2571
112 Q A -1.3555 mutated: NA112Q
113 N A -2.2639
114 T A -1.9930
115 E A -3.0425
116 G A -2.6689
117 D A -2.6800
118 W A -1.4139
119 W A -1.0117
120 L A -0.0508
121 A A 0.0000
122 H A -0.6094
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8780
127 G A -0.8169
128 Q A -1.4119
129 T A -0.5750
130 G A 0.0000
131 Y A 0.1056
132 I A 0.0000
133 P A 0.0000
134 S A -1.2821
135 N A -1.2490
136 Y A -0.2043
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015