Project name: test1

Status: done

submitted: 2019-03-14 14:47:44, status changed: 2019-03-14 14:52:31
Settings
Chain sequence(s) A: IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Distance of aggregation 5 Å
Dynamic mode No
Show buried residues

Minimal score value
-2.3705
Maximal score value
0.8138
Average score
-0.4552
Total score value
-45.0656

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 I A 0.5407
2 D A -1.2594
3 V A 0.0000
4 L A 0.4154
5 L A 0.0000
6 G A 0.0000
7 A A -0.3296
8 D A -2.1166
9 D A -2.1883
10 G A -0.7322
11 S A -0.0850
12 L A 0.5330
13 A A 0.1178
14 F A 0.0000
15 V A 0.6875
16 P A 0.0357
17 S A -0.4085
18 E A -1.8985
19 F A -0.1439
20 S A -0.1527
21 I A 0.0000
22 S A -0.2155
23 P A -0.2275
24 G A -0.4210
25 E A -1.1258
26 K A -1.5156
27 I A 0.0000
28 V A -0.0654
29 F A 0.0000
30 K A -0.5507
31 N A 0.0000
32 N A -0.1382
33 A A -0.0842
34 G A -0.2365
35 F A 0.6220
36 P A -0.0543
37 H A 0.0000
38 N A 0.0000
39 I A 0.0000
40 V A 0.0000
41 F A 0.0000
42 D A -1.0472
43 E A -2.2823
44 D A -2.1430
45 S A -0.3828
46 I A 0.2066
47 P A -0.0256
48 S A -0.3046
49 G A -0.4419
50 V A 0.0392
51 D A -1.1649
52 A A -0.2590
53 S A -0.5224
54 K A -1.7389
55 I A 0.0000
56 S A -0.0122
57 M A 0.0926
58 S A -0.3909
59 E A -2.1698
60 E A -2.3705
61 D A -1.3394
62 L A 0.7066
63 L A 0.0000
64 N A -1.2757
65 A A -0.5028
66 K A -1.7778
67 G A -0.9233
68 E A -0.8783
69 T A -0.2143
70 F A -0.0352
71 E A -1.7156
72 V A 0.0000
73 A A -0.1571
74 L A 0.0000
75 S A -0.4605
76 N A -1.6266
77 K A -1.9560
78 G A -0.7174
79 E A -1.6218
80 Y A 0.0000
81 S A -0.1866
82 F A 0.0000
83 Y A 0.2986
84 C A 0.0000
85 S A -0.0979
86 P A -0.2525
87 H A -0.3287
88 Q A -0.9095
89 G A -0.6012
90 A A -0.1129
91 G A -0.4556
92 M A 0.0000
93 V A 0.8138
94 G A 0.0000
95 K A -1.2957
96 V A 0.0000
97 T A -0.2543
98 V A 0.0000
99 N A -1.2730

 

Laboratory of Theory of Biopolymers 2015