Project name: SH3_Y92K

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92K
Energy difference between WT (input) and mutated protein (by FoldX)	1.18738 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.5963
• Maximal score value: 1.2514
• Average score: -0.9672
• Total score value: -58.0325

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1000
87	V	A	-0.6164
88	A	A	0.0000
89	L	A	-0.3501
90	Y	A	-0.8354
91	D	A	-3.0633
92	K	A	-2.5587	mutated: YA92K
93	E	A	-3.1175
94	S	A	-2.3154
95	R	A	-2.8498
96	T	A	-2.1776
97	E	A	-2.3718
98	T	A	-1.2707
99	D	A	-1.4275
100	L	A	0.0000
101	S	A	-2.0672
102	F	A	0.0000
103	K	A	-3.5963
104	K	A	-2.9286
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2485
110	I	A	0.4381
111	V	A	1.2514
112	N	A	-0.4072
113	N	A	-1.7982
114	T	A	-1.7216
115	E	A	-2.9157
116	G	A	-2.5910
117	D	A	-2.6562
118	W	A	-1.2815
119	W	A	-0.6735
120	L	A	0.4110
121	A	A	0.0000
122	H	A	-0.3838
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8781
127	G	A	-0.8169
128	Q	A	-1.4174
129	T	A	-0.5046
130	G	A	0.0000
131	Y	A	0.2078
132	I	A	0.0000
133	P	A	-0.5877
134	S	A	-1.2618
135	N	A	-1.2268
136	Y	A	-0.2332
137	V	A	0.0000
138	A	A	-0.0130
139	P	A	-0.1505
140	S	A	-0.1759