Project name: 1BK2_Y [mutate: EA7Y, KA60Y]

Chain sequence(s)	A: KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	EA7Y, KA60Y
Energy difference between WT (input) and mutated protein (by FoldX)	0.151578 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.2195
• Maximal score value: 1.2233
• Average score: -1.0108
• Total score value: -57.6171

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
6	K	A	-1.3092
7	Y	A	0.3152	mutated: EA7Y
8	L	A	1.2233
9	V	A	0.0000
10	L	A	0.7708
11	A	A	0.0000
12	L	A	-0.2728
13	Y	A	-0.7911
14	D	A	-2.9495
15	Y	A	0.0000
16	Q	A	-2.5738
17	E	A	-2.4261
18	K	A	-2.6842
19	S	A	-1.8071
20	P	A	-1.5015
21	R	A	-2.1733
22	E	A	0.0000
23	V	A	0.0000
24	T	A	-2.2809
25	M	A	0.0000
26	K	A	-3.2195
27	K	A	-2.6485
28	G	A	-1.4208
29	D	A	-0.9061
30	I	A	1.1064
31	L	A	0.0000
32	T	A	0.0308
33	L	A	0.0000
34	L	A	-0.5530
35	N	A	-1.0380
36	S	A	-1.3643
37	T	A	-1.4145
38	N	A	-2.6085
39	K	A	-3.0532
40	D	A	-2.7457
41	W	A	-1.4425
42	W	A	-0.9807
43	K	A	-1.1344
44	V	A	0.0000
45	E	A	-1.9390
46	V	A	-1.8315
47	N	A	-2.2315
48	G	A	-2.3895
49	R	A	-3.1699
50	Q	A	-2.8138
51	G	A	0.0000
52	F	A	-1.0765
53	V	A	0.0000
54	P	A	-0.5567
55	A	A	-0.9082
56	A	A	-0.2187
57	Y	A	0.1837
58	V	A	0.0000
59	K	A	0.1904
60	Y	A	1.2195	mutated: KA60Y
61	L	A	0.8300
62	D	A	-1.0527