Project name: SH3_T114M

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	TA114M
Energy difference between WT (input) and mutated protein (by FoldX)	0.323565 kcal/mol Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.5342
• Average score: -0.8174
• Total score value: -49.0455

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4510
82	S	A	-0.6826
83	H	A	-0.7912
84	M	A	0.2668
85	T	A	0.0000
86	F	A	-0.1044
87	V	A	-0.6223
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1610
97	E	A	-2.3596
98	T	A	-1.2565
99	D	A	-1.3485
100	L	A	0.0000
101	S	A	-1.9121
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0714
108	L	A	0.0000
109	Q	A	-0.2087
110	I	A	0.5241
111	V	A	1.5342
112	N	A	0.2312
113	N	A	-1.1113
114	M	A	-0.5117	mutated: TA114M
115	E	A	-2.3346
116	G	A	-2.3110
117	D	A	-2.5576
118	W	A	-1.1603
119	W	A	-0.3997
120	L	A	0.6517
121	A	A	0.0000
122	H	A	-0.3555
123	S	A	0.0000
124	L	A	-0.2796
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4119
129	T	A	-0.5056
130	G	A	0.0000
131	Y	A	0.2039
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2934
135	N	A	-1.2488
136	Y	A	-0.2041
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1505
140	S	A	-0.1759