Project name: SH3_T96K

Status: done

submitted: 2019-03-14 15:17:11, status changed: 2019-03-14 16:18:13
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues TA96K
Energy difference between WT (input) and mutated protein (by FoldX) -0.587026 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.7381
Maximal score value
1.2501
Average score
-0.9686
Total score value
-58.1163

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.4510
82 S A -0.6826
83 H A -0.7912
84 M A 0.2668
85 T A 0.0000
86 F A -0.1044
87 V A -0.6223
88 A A 0.0000
89 L A -0.3132
90 Y A -0.7383
91 D A -2.8561
92 Y A -2.0960
93 E A -3.0629
94 S A 0.0000
95 R A -3.5502
96 K A -3.7381 mutated: TA96K
97 E A -3.1008
98 T A -1.6732
99 D A -1.6799
100 L A 0.0000
101 S A -2.0572
102 F A 0.0000
103 K A -3.4857
104 K A -2.8626
105 G A -1.9621
106 E A 0.0000
107 R A -2.0714
108 L A 0.0000
109 Q A -0.2491
110 I A 0.4375
111 V A 1.2501
112 N A -0.4251
113 N A -1.8222
114 T A -1.7385
115 E A -2.9476
116 G A -2.6201
117 D A -2.7043
118 W A -1.3656
119 W A -0.7006
120 L A 0.4196
121 A A 0.0000
122 H A -0.3837
123 S A 0.0000
124 L A -0.2796
125 T A -0.7803
126 T A -0.8781
127 G A -0.8169
128 Q A -1.3970
129 T A -0.4688
130 G A 0.0000
131 Y A 0.0959
132 I A 0.0000
133 P A 0.0000
134 S A -1.2985
135 N A -1.2542
136 Y A -0.2092
137 V A 0.0000
138 A A -0.0212
139 P A -0.1505
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015