Project name: SH3_Q109G

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	QA109G
Energy difference between WT (input) and mutated protein (by FoldX)	1.72931 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.3859
• Average score: -0.8373
• Total score value: -50.2353

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.3793
82	S	A	-0.5878
83	H	A	-0.7255
84	M	A	0.3868
85	T	A	0.0202
86	F	A	0.0504
87	V	A	-0.5442
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2410
99	D	A	-1.3224
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-1.8116
108	L	A	0.0000
109	G	A	0.4111	mutated: QA109G
110	I	A	0.7101
111	V	A	1.3859
112	N	A	-0.3601
113	N	A	-1.8097
114	T	A	-1.7328
115	E	A	-2.9363
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3424
119	W	A	-0.7110
120	L	A	0.4592
121	A	A	0.0000
122	H	A	-0.2025
123	S	A	0.0000
124	L	A	0.3121
125	T	A	-0.5534
126	T	A	-0.7439
127	G	A	-0.6746
128	Q	A	-1.3605
129	T	A	-0.4249
130	G	A	0.0000
131	Y	A	0.1984
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2835
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0223
139	P	A	-0.0865
140	S	A	-0.1781