Project name: SH3_L120R

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA120R
Energy difference between WT (input) and mutated protein (by FoldX)	1.55683 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4841
• Maximal score value: 0.46
• Average score: -1.018
• Total score value: -61.08

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4986
82	S	A	-0.6820
83	H	A	-0.7908
84	M	A	0.2676
85	T	A	0.0000
86	F	A	-0.1034
87	V	A	-0.6218
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8530
92	Y	A	-2.1056
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7832
96	T	A	-2.1639
97	E	A	-2.3625
98	T	A	-1.4196
99	D	A	-1.5561
100	L	A	0.0000
101	S	A	-1.9129
102	F	A	0.0000
103	K	A	-3.4841
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0694
108	L	A	0.0000
109	Q	A	-0.5179
110	I	A	-0.0830
111	V	A	0.4600
112	N	A	-1.0468
113	N	A	-2.1949
114	T	A	-1.9267
115	E	A	-3.0881
116	G	A	-2.6116
117	D	A	-2.7095
118	W	A	-1.6730
119	W	A	-1.4220
120	R	A	-1.0028	mutated: LA120R
121	A	A	0.0000
122	H	A	-0.7371
123	S	A	0.0000
124	L	A	-0.2696
125	T	A	-0.7775
126	T	A	-0.8713
127	G	A	-0.8059
128	Q	A	-1.3944
129	T	A	-0.7765
130	G	A	0.0000
131	Y	A	-0.4727
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.4581
135	N	A	-1.2527
136	Y	A	-0.2070
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1501
140	S	A	-0.1759