Project name: SH3_L124P

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	LA124P
Energy difference between WT (input) and mutated protein (by FoldX)	2.66241 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4836
• Maximal score value: 1.1636
• Average score: -0.9719
• Total score value: -58.3129

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4793
82	S	A	-0.7205
83	H	A	-0.8184
84	M	A	0.2180
85	T	A	0.0000
86	F	A	-0.1668
87	V	A	-0.6545
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1055
93	E	A	-2.8815
94	S	A	0.0000
95	R	A	-2.7837
96	T	A	-2.1540
97	E	A	-2.3526
98	T	A	-1.2408
99	D	A	-1.3222
100	L	A	0.0000
101	S	A	-1.9031
102	F	A	0.0000
103	K	A	-3.4836
104	K	A	-2.8616
105	G	A	-1.9619
106	E	A	0.0000
107	R	A	-2.4543
108	L	A	0.0000
109	Q	A	-0.7440
110	I	A	0.2966
111	V	A	1.1636
112	N	A	-0.4582
113	N	A	-1.8138
114	T	A	-1.7326
115	E	A	-2.9361
116	G	A	-2.6085
117	D	A	-2.6844
118	W	A	-1.3421
119	W	A	-0.7062
120	L	A	0.3539
121	A	A	0.0000
122	H	A	-0.8210
123	S	A	0.0000
124	P	A	-1.3868	mutated: LA124P
125	T	A	-1.2946
126	T	A	-1.1962
127	G	A	-1.1692
128	Q	A	-1.6168
129	T	A	-0.6854
130	G	A	0.0000
131	Y	A	0.2085
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2855
135	N	A	-1.2485
136	Y	A	-0.2039
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1763
140	S	A	-0.1759