Project name: SH3_Y92V

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	YA92V
Energy difference between WT (input) and mutated protein (by FoldX)	4.47336 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4674
• Maximal score value: 1.2561
• Average score: -0.9312
• Total score value: -55.8693

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4506
82	S	A	-0.6820
83	H	A	-0.7908
84	M	A	0.2676
85	T	A	0.0000
86	F	A	-0.0996
87	V	A	-0.6117
88	A	A	0.0000
89	L	A	-0.2794
90	Y	A	-0.6799
91	D	A	-2.8147
92	V	A	-2.0867	mutated: YA92V
93	E	A	-2.9029
94	S	A	-2.2340
95	R	A	-2.8217
96	T	A	-2.2087
97	E	A	-2.4005
98	T	A	-1.3192
99	D	A	-1.4717
100	L	A	0.0000
101	S	A	-1.9408
102	F	A	0.0000
103	K	A	-3.4674
104	K	A	-2.8356
105	G	A	-1.9552
106	E	A	0.0000
107	R	A	-2.0707
108	L	A	0.0000
109	Q	A	-0.2441
110	I	A	0.4419
111	V	A	1.2561
112	N	A	-0.3981
113	N	A	-1.7933
114	T	A	-1.7186
115	E	A	-2.9130
116	G	A	-2.5856
117	D	A	-2.6471
118	W	A	-1.2785
119	W	A	-0.6745
120	L	A	0.4018
121	A	A	0.0000
122	H	A	-0.3819
123	S	A	0.0000
124	L	A	-0.2789
125	T	A	-0.7803
126	T	A	-0.8781
127	G	A	-0.8169
128	Q	A	-1.4276
129	T	A	-0.5220
130	G	A	0.0000
131	Y	A	0.1725
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.2490
135	N	A	-1.2150
136	Y	A	-0.1431
137	V	A	0.0000
138	A	A	-0.0138
139	P	A	-0.1501
140	S	A	-0.1759