Project name: abeta

Chain sequence(s)	A: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Distance of aggregation	10 Å
Dynamic mode	No

• Minimal score value: -3.0904
• Maximal score value: 3.5577
• Average score: -0.187
• Total score value: -7.4818

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	D	A	-2.2108
2	A	A	-1.8025
3	E	A	-2.4978
4	F	A	-1.5403
5	R	A	-3.0904
6	H	A	-2.9723
7	D	A	-2.9017
8	S	A	-1.7427
9	G	A	-1.0102
10	Y	A	0.0342
11	E	A	-1.5986
12	V	A	-1.0337
13	H	A	-1.8100
14	H	A	-1.6755
15	Q	A	-1.2704
16	K	A	-0.9872
17	L	A	1.0847
18	V	A	0.3757
19	F	A	0.6545
20	F	A	1.6483
21	A	A	-0.0548
22	E	A	-1.8699
23	D	A	-1.6472
24	V	A	-0.3203
25	G	A	-1.5634
26	S	A	-1.6868
27	N	A	-2.6177
28	K	A	-2.3893
29	G	A	-0.7613
30	A	A	1.2825
31	I	A	3.0193
32	I	A	3.2722
33	G	A	2.6298
34	L	A	3.2016
35	M	A	3.5577
36	V	A	3.1758
37	G	A	1.8483
38	G	A	1.6129
39	V	A	3.1150
40	V	A	3.0605