Project name: SH3_N112S

Chain sequence(s)	A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation	10 Å
Dynamic mode	No
Mutated residues	NA112S
Energy difference between WT (input) and mutated protein (by FoldX)	1.43716 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

• Minimal score value: -3.4838
• Maximal score value: 1.4657
• Average score: -0.8704
• Total score value: -52.2231

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
81	G	A	-0.4528
82	S	A	-0.6820
83	H	A	-0.7908
84	M	A	0.2676
85	T	A	0.0000
86	F	A	-0.1034
87	V	A	-0.6218
88	A	A	0.0000
89	L	A	-0.3125
90	Y	A	-0.7367
91	D	A	-2.8528
92	Y	A	-2.1057
93	E	A	-2.8817
94	S	A	0.0000
95	R	A	-2.7840
96	T	A	-2.1647
97	E	A	-2.3633
98	T	A	-1.2628
99	D	A	-1.3631
100	L	A	0.0000
101	S	A	-1.9165
102	F	A	0.0000
103	K	A	-3.4838
104	K	A	-2.8616
105	G	A	-1.9621
106	E	A	0.0000
107	R	A	-2.0707
108	L	A	0.0000
109	Q	A	-0.1888
110	I	A	0.5628
111	V	A	1.4657
112	S	A	0.0476	mutated: NA112S
113	N	A	-1.5930
114	T	A	-1.5928
115	E	A	-2.8574
116	G	A	-2.5680
117	D	A	-2.7079
118	W	A	-1.3263
119	W	A	-0.5852
120	L	A	0.5599
121	A	A	0.0000
122	H	A	-0.3418
123	S	A	0.0000
124	L	A	-0.2789
125	T	A	-0.7803
126	T	A	-0.8780
127	G	A	-0.8169
128	Q	A	-1.4120
129	T	A	-0.5103
130	G	A	0.0000
131	Y	A	0.1937
132	I	A	0.0000
133	P	A	0.0000
134	S	A	-1.3036
135	N	A	-1.2524
136	Y	A	-0.2068
137	V	A	0.0000
138	A	A	-0.0212
139	P	A	-0.1501
140	S	A	-0.1759