Project name: SH3_V111K

Status: done

submitted: 2019-03-14 15:25:35, status changed: 2019-03-14 17:11:56
Settings
Chain sequence(s) A: GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Distance of aggregation 10 Å
Dynamic mode No
Mutated residues VA111K
Energy difference between WT (input) and mutated protein (by FoldX) -0.605811 kcal/mol

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.4838
Maximal score value
0.2718
Average score
-1.1006
Total score value
-66.0387

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
81 G A -0.8732
82 S A -0.6787
83 H A -0.7885
84 M A 0.2718
85 T A 0.0000
86 F A -0.0980
87 V A -0.6190
88 A A 0.0000
89 L A -0.3125
90 Y A -0.7367
91 D A -2.8528
92 Y A -2.1055
93 E A -2.8815
94 S A 0.0000
95 R A -2.7837
96 T A -2.1605
97 E A -2.3591
98 T A -1.2556
99 D A -1.3470
100 L A 0.0000
101 S A -1.9089
102 F A 0.0000
103 K A -3.4838
104 K A -2.8616
105 G A -1.9621
106 E A 0.0000
107 R A -2.0615
108 L A 0.0000
109 Q A -1.1463
110 I A -1.1986
111 K A -2.1459 mutated: VA111K
112 N A -1.9688
113 N A -2.5490
114 T A -2.0925
115 E A -2.9116
116 G A -2.5932
117 D A -2.6907
118 W A -1.3416
119 W A -1.3581
120 L A -0.7190
121 A A 0.0000
122 H A -1.1474
123 S A 0.0000
124 L A -0.2593
125 T A -0.7731
126 T A -0.8676
127 G A -0.7993
128 Q A -1.3927
129 T A -0.9076
130 G A 0.0000
131 Y A -0.2257
132 I A 0.0000
133 P A 0.0000
134 S A -1.2950
135 N A -1.2485
136 Y A -0.2039
137 V A 0.0000
138 A A -0.0212
139 P A -0.1478
140 S A -0.1759

 

Laboratory of Theory of Biopolymers 2015