Project name: V67D [mutate: VA67D]

Status: done

submitted: 2019-03-08 19:21:53, status changed: 2019-03-08 21:40:00
Settings
Chain sequence(s) A: MLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYT
Distance of aggregation 10 Å
Dynamic mode Yes
Mutated residues VA67D
Energy difference between WT (input) and mutated protein (by FoldX) 5.35139 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Changes in protein stability upon mutation are calculated using the FoldX forcefield. Computational prediction of protein stability is used with the intention of preventing the experimental characterization of proteins bearing mutations that significantly destabilize their structure. Mutations resulting in a predicted reduction in protein stability ≥ 1 kcal/mol are considered disruptive.

Show buried residues

Minimal score value
-3.3486
Maximal score value
1.6496
Average score
-0.618
Total score value
-76.6356

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.0645
2 L A 0.0000
3 R A -1.0047
4 V A 0.0000
5 F A 0.0013
6 I A 0.0000
7 L A 1.0763
8 Y A 1.1225
9 A A 0.0000
10 E A -1.8433
11 N A -2.2429
12 V A 0.0000
13 H A -1.2777
14 T A 0.0000
15 P A -1.4242
16 D A -2.1685
17 T A -1.1637
18 D A -0.8626
19 I A 1.1256
20 S A 0.3996
21 D A -0.0506
22 A A 0.0000
23 Y A -0.4517
24 C A 0.0000
25 S A -1.4861
26 A A 0.0000
27 V A -0.9900
28 F A 0.0000
29 A A -0.5389
30 G A -0.7605
31 V A -1.0472
32 K A -2.3813
33 K A -2.3094
34 R A -2.7389
35 T A -1.4102
36 K A -1.1028
37 V A 0.2588
38 I A 1.6496
39 K A 0.6484
40 N A -0.2448
41 S A -0.3318
42 V A -0.6371
43 N A -1.3526
44 P A 0.0000
45 V A 1.4129
46 W A 0.0000
47 N A -0.4262
48 E A 0.0000
49 G A -0.7631
50 F A -0.9418
51 E A -1.2112
52 W A -0.8588
53 D A -1.6272
54 L A -0.5142
55 K A -1.5234
56 G A -0.8890
57 I A -0.1670
58 P A -0.4608
59 L A -0.9719
60 D A -2.5466
61 Q A -2.8585
62 G A -2.4234
63 S A 0.0000
64 E A -2.1257
65 L A 0.0000
66 H A -1.0285
67 D A 0.0000 mutated: VA67D
68 V A 0.0572
69 V A 0.0000
70 K A -0.9561
71 D A 0.0000
72 H A -1.1750
73 E A -0.9302
74 T A -0.4716
75 M A 0.1798
76 G A -0.8259
77 R A -1.3824
78 N A -1.7891
79 R A -1.0021
80 F A 0.0853
81 L A 0.0000
82 G A 0.0000
83 E A -0.2139
84 A A 0.0000
85 K A -1.3824
86 V A 0.0000
87 P A -1.9911
88 L A 0.0000
89 R A -3.3486
90 E A -2.7173
91 V A -1.1690
92 L A -1.0672
93 A A -1.1363
94 T A -0.7651
95 P A -0.2635
96 S A -0.1785
97 L A 0.0000
98 S A -0.3369
99 A A -0.3970
100 S A -0.4147
101 F A -0.4127
102 N A -0.9191
103 A A 0.0000
104 P A -0.4579
105 L A 0.0000
106 L A 0.4894
107 D A 0.0000
108 T A -0.8082
109 K A -1.9908
110 K A -1.6881
111 Q A -1.8289
112 P A -0.9702
113 T A 0.0000
114 G A -1.0018
115 A A 0.0000
116 S A -0.9716
117 L A 0.0000
118 V A 0.7931
119 L A 0.0000
120 Q A -0.4181
121 V A 0.0000
122 S A -0.1123
123 Y A 0.5153
124 T A 0.1372

Above is the comparison between the input structure and the most aggregation prone model (predicted in the flexibility simulations, download both models in the PDB file format , download table with rmsd values ). The picture presents the most aggregation prone model (in blue) superimposed on the input structure (in red). The plot shows rmsd profile (distances between residues of the superimposed structures).

Dynamic mode uses CABS-flex simulations of protein structure fluctuations. The structure fluctuations may have impact on the size and extent of aggregation "hot-spots" on the protein surface. The dynamic mode uses the following pipeline: (1) based on the input structure, CABS-flex predicts a set of different models reflecting protein dynamics in solution; (2) for each of these models A3D score is calculated; (3) finally, the most aggregation prone model (the model with the highest A3D score, -0.618 in this case) is selected and presented in A3D results.


 

Laboratory of Theory of Biopolymers 2015